General Information

  • ID:  hor005522
  • Uniprot ID:  P37085
  • Protein name:  PDH precursor-related peptide
  • Gene name:  NA
  • Organism:  Faxonius limosus (Spinycheek crayfish) (Orconectes limosus)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  Optical ganglia of the eyestalk.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Faxonius (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  QELKYPEREVVAELAAQIYGWPGSLGTMAGGPH
  • Length:  33(21-53)
  • Propeptide:  MRSAMVVLVLVAMVAVFTRAQELKYPEREVVAELAAQIYGWPGSLGTMAGGPHKRNSELINSILGLPKVMNEAGRR
  • Signal peptide:  MRSAMVVLVLVAMVAVFTRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neurom
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P37085-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005522_AF2.pdbhor005522_ESM.pdb

Physical Information

Mass: 412698 Formula: C160H244N42O48S
Absent amino acids: CDFN Common amino acids: G
pI: 4.62 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -33.33 Boman Index: -2532
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 76.97
Instability Index: 2803.94 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  8477858
  • Title:  Structure and localization of mRNA encoding a pigment dispersing hormone (PDH) in the eyestalk of the crayfish Orconectes limosus.